Algorithms in Bioinformatics: A Practical Introduction by Wing-Kin Sung

By Wing-Kin Sung

Built from the author’s personal educating fabric, Algorithms in Bioinformatics: a realistic advent presents an in-depth creation to the algorithmic thoughts utilized in bioinformatics. for every subject, the writer truly info the organic motivation and accurately defines the corresponding computational difficulties. He additionally comprises precise examples to demonstrate every one set of rules and end-of-chapter workouts for college kids to familiarize themselves with the subjects. Supplementary fabric is accessible at http://www.comp.nus.edu.sg/~ksung/algo_in_bioinfo/

This classroom-tested textbook starts with easy molecular biology suggestions. It then describes how one can degree series similarity, offers easy functions of the suffix tree, and discusses the matter of looking out series databases. After introducing equipment for aligning a number of organic sequences and genomes, the textual content explores functions of the phylogenetic tree, tools for evaluating phylogenetic bushes, the matter of genome rearrangement, and the matter of motif discovering. It additionally covers tools for predicting the secondary constitution of RNA and for reconstructing the peptide series utilizing mass spectrometry. the ultimate bankruptcy examines the computational challenge concerning inhabitants genetics.

Show description

Read or Download Algorithms in Bioinformatics: A Practical Introduction PDF

Best algorithms books

A History of Algorithms: From the Pebble to the Microchip

Amazon hyperlink: http://www. amazon. com/History-Algorithms-From-Pebble-Microchip/dp/3540633693

The improvement of computing has reawakened curiosity in algorithms. usually missed by means of historians and glossy scientists, algorithmic methods were instrumental within the improvement of basic principles: perform ended in thought simply up to the opposite direction around. the aim of this publication is to provide a ancient historical past to modern algorithmic perform.

Algorithms and Data Structures for External Memory (Foundations and Trends(R) in Theoretical Computer Science)

Info units in huge purposes are usually too significant to slot thoroughly contained in the computer's inner reminiscence. The ensuing input/output communique (or I/O) among speedy inner reminiscence and slower exterior reminiscence (such as disks) could be a significant functionality bottleneck. Algorithms and information buildings for exterior reminiscence surveys the state-of-the-art within the layout and research of exterior reminiscence (or EM) algorithms and information constructions, the place the target is to take advantage of locality and parallelism as a way to decrease the I/O expenses.

Nonlinear Assignment Problems: Algorithms and Applications

Nonlinear project difficulties (NAPs) are traditional extensions of the vintage Linear project challenge, and regardless of the efforts of many researchers during the last 3 many years, they nonetheless stay many of the toughest combinatorial optimization difficulties to resolve precisely. the aim of this booklet is to supply in one quantity, significant algorithmic facets and functions of NAPs as contributed via prime foreign specialists.

Algorithms and Computation: 8th International Workshop, WALCOM 2014, Chennai, India, February 13-15, 2014, Proceedings

This e-book constitutes the revised chosen papers of the eighth foreign Workshop on Algorithms and Computation, WALCOM 2014, held in Chennai, India, in February 2014. The 29 complete papers provided including three invited talks have been rigorously reviewed and chosen from sixty two submissions. The papers are prepared in topical sections on computational geometry, algorithms and approximations, dispensed computing and networks, graph algorithms, complexity and boundaries, and graph embeddings and drawings.

Additional resources for Algorithms in Bioinformatics: A Practical Introduction

Example text

1. Transcription: DNA is transcribed to mRNA. During the transcription process, an mRNA is synthesized from a DNA template resulting in the transfer of genetic information from the DNA molecule to the mRNA. 2. Translation: mRNA is translated to protein. In the translation process, the mRNA is translated to an amino acid sequence by stitching the amino acids one by one; thus the information obtained from DNA is transferred to the protein, through mRNA. The subsections below discuss transcription (prokaryotes), transcription (eukaryotes), and translation.

5. For the following mRNA sequence, can you extract its 5’ UTR, 3’ UTR and the protein sequence? 1 Introduction The earliest research in sequence comparison can be dated back to 1983, when Doolittle et al. [82] searched for platelet-derived growth factor (PDGF) in their database. They found that PDGF is similar to v-sis onc gene. DR?? 34 p28sis 61 LARGKRSLGSLSVAEPAMIAECKTRTEVFEISRRLIDRTN 100 At that time, the function of v-sis onc gene was still unknown. Based on the similarity between v-sis onc gene and PDGF, they claimed that the transforming protein of the primate sarcoma virus and the platelet-derived growth factor are derived from the same or closely related cellular genes.

1, where δ(x, y) = 2, −1, −1, −1 for match, mismatch, delete, and insert, respectively. One possible alignment of two DNA sequences S = ACAAT CC and T = AGCAT GC is shown below. S = A-CAATCC T = AGCA-TGC The above alignment has five matches, one mismatch, one insert, and one delete. Thus, the similarity score of this alignment is 7 (2 ∗ 5 − 1 − 1 − 1 = 7). We can check that this alignment has the maximum score. Hence, it is an optimal alignment. Note that S and T may have more than one optimal alignment.

Download PDF sample

Rated 4.11 of 5 – based on 25 votes